Anti-Adiponectin Anticorpo [5H7] (A279452)

Anti-Adiponectin Antibody [5H7]

Mouse monoclonal [5H7] antibody to Adiponectin.

This antibody recognises the collagen-like domain of human adiponectin, also known as Acrp30, Gelatin-binding protein, Adipose most abundant gene transcript 1 protein, Adipocyte complement-related 30 kDa protein or apM-1. Adiponectin a 244 amino acid ~30 kDa major adipokine secreted into the bloodstream from adipose tissue into the circulation where it exists as three distinct, low, medium and high molecular weight oligomeric forms (UniProt: Q15848).Circulating adiponectin levels are correlated with insulin sensitivity and decreased levels parallel the change in insulin sensitivity during the progression to type II diabetes. Mutations in the adiponectin gene can also lead to adiponectin deficiency characterized by obesity, diabetes, high blood pressure and circulating cholesterol. Mouse anti Human adiponectin, clone 5H7 had been used successfully as a detection reagent in the development of sensitive sandwich ELISA's in conjunction with Mouse anti Human adiponectin, clone Adn27 (MCA4652) or Mouse anti Human adiponectin antibody, clone Adn36 (MCA4653) as capture reagents.

ELISA, WB

WB: 1:1,000 - 1:2,000

Human, Mouse

Recombinant human adiponectin (amino acids 15-244) purified from E. coli .

GHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Mouse

Monoclonal

5H7

IgG1

Unconjugated

Protein G affinity chromatography of ascites.

Approximately 64 kDa in mouse liver cell lysates.

Liquid

Supplied in Phosphate Buffered Saline with 10% Glycerol and 0.02% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human adiponectin, clone 5H7 recognizes the collagen-like domain of human adiponectin, also known as Acrp30, Gelatin-binding protein, Adipose most abundant gene transcript 1 protein, Adipocyte complement-related 30 kDa protein or apM-1. Adiponectin a 244 amino acid ~30 kDa major adipokine secreted into the bloodstream from adipose tissue into the circulation where it exists as three distinct, low, medium and high molecular weight oligomeric forms (UniProt: Q15848).Circulating adiponectin levels are correlated with insulin sensitivity and decreased levels parallel the change in insulin sensitivity during the progression to type II diabetes (Heilbronn et al. 2011). Mutations in the adiponectin gene can also lead to adiponectin deficiency characterized by obesity, diabetes, high blood pressure and circulating cholesterol (Takahashi et al. 2000).Mouse anti Human adiponectin, clone 5H7 had been used successfully as a detection reagent in the development of sensitive sandwich ELISA's in conjunction with Mouse anti Human adiponectin, clone Adn27 (MCA4652) or Mouse anti Human adiponectin antibody, clone Adn36 (MCA4653) as capture reagents.

30 kDa adipocyte complement related protein, 30 kDa adipocyte complement-related protein, ACDC, ACRP30, Adipocyte, Adipocyte C1q and collagen domain containing protein, Adipocyte complement related 30 kDa protein, Adipocyte complement related protein of 30 kDa, Adipocyte complement-related 30 kDa protein, adipocyte-specific secretory protein, Adiponectin precursor, adiponectin, C1Q and collagen domain containing, Adipoq, Adipose most abundant gene transcript 1, Adipose most abundant gene transcript 1 protein, Adipose specific collagen like factor, ADIPO_HUMAN, ADIPQTL1, ADPN, APM 1, apM-1, APM1, C1q and collagen domain-containing protein, GBP28, Gelatin binding protein , Gelatin binding protein 28, Gelatin-binding protein