Anti-CD11b Anticorpo (A13522)

Anti-CD11b Antibody

Rabbit polyclonal antibody to CD11b.

WB, IHC, ICC/IF

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 145-340 of CD11b/ITGAM (NP_000623.2).

PQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQT

Rabbit

Polyclonal

IgG

Unconjugated

170 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

antigen CD11b (p170), Antigen CD11b p170, CD11 antigen like family member B, CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement component 3 receptor 3 subunit, Complement Component Receptor 3 Alpha, Complement receptor type 3, alpha subunit, CR 3 alpha chain, CR 3 alpha chain (CR3A), CR-3 alpha chain, CR3, CR3A, F730045J24Rik, Integrin Alpha M, Integrin alpha M chain, Integrin alpha-M, Integrin beta 2 alpha subunit, Integrin subunit alpha M, integrin, alpha M (complement component 3 receptor 3 subunit), ITAM_HUMAN, ITGAM, Leukocyte adhesion receptor MO1, Ly-40, MAC 1, Mac-1a, MAC1, Mac1, alpha subunit, MAC1A, Macrophage antigen alpha polypeptide, MGC117044, Mo1, alpha subunit, MO1A, Neutrophil adherence receptor, Neutrophil adherence receptor alpha M subunit, SLEB6