Anti-CD3 epsilon Anticorpo [ARC51750] (A308227)

Anti-CD3 epsilon Antibody [ARC51750]

Rabbit monoclonal [ARC51750] antibody to CD3 epsilon.

WB, IHC, Flow Cytometry

WB: 1:500-1:2,000, IHC: 1:500-1:1,000, Flow Cytometry: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD3E (NP_000724.1).

PQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYY

Rabbit

Monoclonal

ARC51750

IgG

Affinity purification.

23 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CD3e, CD3E antigen epsilon polypeptide, CD3e antigen epsilon polypeptide (TiT3 complex), CD3E antigen, epsilon subunit, CD3e molecule epsilon, CD3e molecule, epsilon (CD3 TCR complex), CD3e molecule, epsilon (CD3-TCR complex), CD3E_HUMAN, IMD18, T cell antigen receptor complex epsilon subunit of T3, T cell surface antigen T3/Leu 4 epsilon chain, T cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, T3E, TCRE