Anti-Heme Oxygenase 1 Anticorpo [ARC53508] (A307278)

Name: Anti-Heme Oxygenase 1 Antibody [ARC53508]
Brand: Antibodies.com
SKU: A307278
Price: 470.0 USD
Availability: InStock

Clicca sull'immagine per la visualizzazione estesa

$470

Anticorpo monoclonale [ARC53508] di coniglio contro Heme Oxygenase 1 per WB, IHC e IP.

Garanzia al 100%

Garanzia di corrispondenza del prezzo

Consegna

Spese di spedizione

$40

Tempi di consegna

5-8 Giorni lavorativi

Contattaci

Telefono

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanzie

Garanzia di qualità al 100%

Garanzia di corrispondenza del prezzo

Tag dei prodotti:

Anticorpo Knockout Convalidato ER Marker

Descrizione Prodotto

Nome

Anti-Heme Oxygenase 1 Antibody [ARC53508]

Descrizione

Rabbit monoclonal [ARC53508] antibody to Heme Oxygenase 1.

Applicazioni

WB, IHC, IP

Diluizioni consigliate

WB: 1:2,000-1:10,000, IHC: 1:50-1:200, IP: 1:500-1:1,000

Reattività

Human, Mouse, Rat

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).

Sequenza

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA

Specie ospite

Rabbit

Clonalità

Monoclonal

Clona ID

ARC53508

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

33 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

32 kD, bK286B10, D8Wsu38e, Heat shock protein, heat shock protein 32 kD, heat shock protein 32kD, Heme oxygenase (decycling) 1, Hemox, Hmox, HMOX 1, Hmox1, HMOX1_HUMAN, HO, HO 1, HO-1, HO1, Hsp32

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (10)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of various cell lines, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of Raw264. 7 cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of HepG2 cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human liver using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human lung using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded mouse liver using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunoprecipitation analysis of 300µg extracts of HepG2 cells using 3µg of Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278). This Western blot was performed on the immunoprecipitate using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:1000.

Mostra più immagini

Prodotti alternativi a Anti-Heme Oxygenase 1 Anticorpo [ARC53508] (A307278)

(5)

A304771

Anti-Heme Oxygenase 1 Anticorpo [1F12-A6]

Anticorpo monoclonale [1F12-A6] di topo contro Heme Oxygenase 1 per WB, IHC, ICC/IF, IP e ELISA.

(3)

A13434