Anti-Umano IgG Anticorpo [ARC53385] (A308177)

Name: Anti-Human IgG Antibody [ARC53385]
Brand: Antibodies.com
SKU: A308177

Clicca sull'immagine per la visualizzazione estesa

Questo prodotto è fuori produzione

Anti-Umano IgG Anticorpo [ARC53385] (A308177) è stato interrotto e non è più disponibile.

Visualizza tutti gli Anti-Human IgG Anticorpi.

Descrizione Prodotto

Nome

Anti-Human IgG Antibody [ARC53385]

Descrizione

Rabbit monoclonal [ARC53385] antibody to Human IgG.

Applicazioni

WB, IHC, ICC/IF, Flow Cytometry

Diluizioni consigliate

WB: 1:2,000-1:4,000, IHC: 1:500-1:1,000, Flow Cytometry: 1:50-1:200, ICC/IF: 1:50-1:200

Reattività

Human

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human Human IgG1 (Fc) (P01857).

Sequenza

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Specie ospite

Rabbit

Clonalità

Monoclonal

Clona ID

ARC53385

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, G1m marker, G2m marker, G3m marker, G4m marker, HDC, Heavy chain disease protein, Human immunglobulin G, Ig gamma 1 chain C region, Ig gamma 2 chain C region, Ig gamma 3 chain C region, Ig gamma 4 chain C region, IgG heavy chain locus, IGHG 1, IGHG 2, IGHG 3, IGHG 4, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Gm1, Immunoglobulin Gm3, Immunoglobulin Gm4, Immunoglobulin heavy constant gamma 1, immunoglobulin heavy constant gamma 1 (G1m marker), Immunoglobulin heavy constant gamma 2, immunoglobulin heavy constant gamma 2 (G2m marker), Immunoglobulin heavy constant gamma 3, immunoglobulin heavy constant gamma 3 (G3m marker), Immunoglobulin heavy constant gamma 4, immunoglobulin heavy constant gamma 4 (G4m marker), MGC117419, MGC45809

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (10)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-Human IgG Antibody [ARC53385] (A308177)

Western blot analysis of extracts of 293T cells, using Anti-Human IgG Antibody [ARC53385] (A308177) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human brain (negative control sample) using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of 293F-IgG(FC) and 293F cells using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of Daudi using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of human tonsil using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F(Transfection) cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F(Transfection) cells, used as blank control (red line).

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F cells, used as blank control (red line).

Mostra più immagini