Anti-IKZF3 Anticorpo [ARC2781] (A306354)

Name: Anti-IKZF3 Antibody [ARC2781]
Brand: Antibodies.com
SKU: A306354
Price: 470.0 USD
Availability: InStock

Clicca sull'immagine per la visualizzazione estesa

$470

Anticorpo monoclonale [ARC2781] di coniglio contro IKZF3 per WB, IHC, ICC/IF e IP.

Garanzia al 100%

Garanzia di corrispondenza del prezzo

Consegna

Spese di spedizione

$40

Tempi di consegna

5-8 Giorni lavorativi

Contattaci

Telefono

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanzie

Garanzia di qualità al 100%

Garanzia di corrispondenza del prezzo

Descrizione Prodotto

Nome

Anti-IKZF3 Antibody [ARC2781]

Descrizione

Rabbit monoclonal [ARC2781] antibody to IKZF3.

Applicazioni

WB, IHC, ICC/IF, IP

Diluizioni consigliate

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500

Reattività

Human, Mouse, Rat

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9).

Sequenza

IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK

Specie ospite

Rabbit

Clonalità

Monoclonal

Clona ID

ARC2781

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

65 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

AIO, Aiolos, IKAROS family zinc finger 3, IKAROS family zinc finger 3 (Aiolos), Ikaros family zinc finger protein 3, IKZF 3, IKZF3_HUMAN, zinc finger DNA binding protein Aiolos, Zinc finger protein Aiolos, Zinc finger protein subfamily 1A 3, Zinc finger protein subfamily 1A 3 (Aiolos), Zinc finger protein subfamily 1A, member 3, ZNFN1A3

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (10)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of Raji cells, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of various cell lines, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of Rat lung, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 90s.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Immunofluorescence - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunofluorescence analysis of rat spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunoprecipitation analysis of 300µg extracts of Raji cells using 3µg of Anti-IKZF3 Antibody [ARC2781] (A306354). This Western blot was performed on the immunoprecipitate using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:500.

Mostra più immagini