Anti-M6PR (cation independent) Anticorpo [ARC51203] (A308940)

Name: Anti-M6PR (cation independent) Antibody [ARC51203]
Brand: Antibodies.com
SKU: A308940

Clicca sull'immagine per la visualizzazione estesa

Questo prodotto è fuori produzione

Anti-M6PR (cation independent) Anticorpo [ARC51203] (A308940) è stato interrotto e non è più disponibile.

Visualizza tutti gli Anti-M6PR (cation independent) Anticorpi.

Descrizione Prodotto

Nome

Anti-M6PR (cation independent) Antibody [ARC51203]

Descrizione

Rabbit monoclonal [ARC51203] antibody to M6PR (cation independent).

Applicazioni

WB, IHC

Diluizioni consigliate

WB: 1:500-1:1,000, IHC: 1:50-1:200

Reattività

Human, Mouse, Rat

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 2140-2300 of human Cation-independent M6PR (IGF2R) (NP_000867.3).

Sequenza

TNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLS

Specie ospite

Rabbit

Clonalità

Monoclonal

Clona ID

ARC51203

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

274 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

300 kDa mannose 6 phosphate receptor, 300 kDa mannose 6-phosphate receptor, Cation independent mannose 6 phosphate receptor, Cation-independent mannose-6-phosphate receptor, CD222, CD222 antigen, CI Man 6 P receptor, CI Man-6-P receptor, CI MPR, CI-M6PR, CI-MPR, CIMPR, IGF 2 receptor, IGF 2R, IGF II receptor, IGF-II receptor, IGF2 receptor, Igf2r, Insulin like growth factor 2 receptor, Insulin like growth factor II receptor, Insulin-like growth factor 2 receptor, Insulin-like growth factor II receptor, M6P R, M6P/IGF2 receptor, M6P/IGF2R, M6PR, mannose 6 phosphate receptor, mannose 6 phosphate receptor, cation independent, MPR 300, MPR300, MPRI, MPRI_HUMAN

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (5)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-M6PR (cation independent) Antibody [ARC51203] (A308940)

Western blot analysis of extracts of various cell lines, using Anti-M6PR (cation independent) Antibody [ARC51203] (A308940) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-M6PR (cation independent) Antibody [ARC51203] (A308940)

Western blot analysis of extracts of Rat liver, using Anti-M6PR (cation independent) Antibody [ARC51203] (A308940) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 90s.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Western Blot - Anti-M6PR (cation independent) Antibody [ARC51203] (A308940)

Western blot analysis of extracts of NIH/3T3 cells, using Anti-M6PR (cation independent) Antibody [ARC51203] (A308940) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 90s.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-M6PR (cation independent) Antibody [ARC51203] (A308940)

Immunohistochemistry analysis of paraffin-embedded rat brain using Anti-M6PR (cation independent) Antibody [ARC51203] (A308940) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.