Anti-RBM3 Anticorpo [ARC2882] (A305721)

Name: Anti-RBM3 Antibody [ARC2882]
Brand: Antibodies.com
SKU: A305721

Clicca sull'immagine per la visualizzazione estesa

Questo prodotto è fuori produzione

Anti-RBM3 Anticorpo [ARC2882] (A305721) è stato interrotto e non è più disponibile.

Visualizza tutti gli Anti-RBM3 Anticorpi.

Descrizione Prodotto

Nome

Anti-RBM3 Antibody [ARC2882]

Descrizione

Rabbit monoclonal [ARC2882] antibody to RBM3.

Applicazioni

WB, IHC, ICC/IF

Diluizioni consigliate

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Reattività

Human, Mouse, Rat

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 58-157 of human RBM3 (P98179).

Sequenza

EHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

Specie ospite

Rabbit

Clonalità

Monoclonal

Clona ID

ARC2882

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

17 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

2600016C11Rik, IS1 RNPL, MGC105811, MGC118410, OTTHUMP00000025800, OTTHUMP00000025802, OTTMUSP00000019634, OTTMUSP00000019635, OTTMUSP00000019636, Putative RNA binding protein 3, Putative RNA-binding protein 3, RBM3_HUMAN, RNA binding motif (RNP1, RRM) protein 3, RNA binding motif protein 3, RNA-binding motif protein 3, RNA-binding protein 3, RNPL, RP23-27I6.7

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (10)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-RBM3 Antibody [ARC2882] (A305721)

Western blot analysis of extracts of various cell lines, using Anti-RBM3 Antibody [ARC2882] (A305721) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded mouse liver using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded rat liver using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded rat ovary using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Immunofluorescence - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunofluorescence analysis of HeLa cells using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Immunofluorescence - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunofluorescence analysis of NIH/3T3 cells using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Immunofluorescence - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunofluorescence analysis of PC-12 cells using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Mostra più immagini