Anti-YAP1 Anticorpo [ARC53477] (A308258)

Name: Anti-YAP1 Antibody [ARC53477]
Brand: Antibodies.com
SKU: A308258
Price: 470.0 USD
Availability: InStock

Clicca sull'immagine per la visualizzazione estesa

$470

Anticorpo monoclonale [ARC53477] di coniglio contro YAP1 per WB, IHC, ICC/IF e IP.

Garanzia al 100%

Garanzia di corrispondenza del prezzo

Consegna

Spese di spedizione

$40

Tempi di consegna

5-8 Giorni lavorativi

Contattaci

Telefono

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanzie

Garanzia di qualità al 100%

Garanzia di corrispondenza del prezzo

Tag dei prodotti:

Anticorpo Knockout Convalidato

Descrizione Prodotto

Nome

Anti-YAP1 Antibody [ARC53477]

Descrizione

Rabbit monoclonal [ARC53477] antibody to YAP1.

Applicazioni

WB, IHC, ICC/IF, IP

Diluizioni consigliate

WB: 1:2,000-1:4,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500

Reattività

Human, Mouse, Rat

Immunogeno

Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).

Sequenza

PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Specie ospite

Rabbit

Clonalità

Monoclonal

Clona ID

ARC53477

Isotipo

IgG

Coniugare

Unconjugated

Purificazione

Affinity purification.

Peso molecolare

72 kDa

Forma del prodotto

Liquid

Formulazione

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Conservazione

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Sinonimi

65 kDa Yes associated protein, 65 kDa Yes-associated protein, COB1, YAP, YAp 1, YAP 65, YAP1_HUMAN, YAP2, YAP65, yes -associated protein delta, Yes associated protein 1, Yes associated protein 1 65kDa, Yes associated protein 2, yes associated protein beta, YKI, Yorkie homolog

Controlli isotipo

Secondari adatti

Dichiarazione di non responsabilità

Questo prodotto è solo per uso di ricerca. Non è inteso per uso diagnostico o terapeutico.

Immagini (11)

Clicca sull'immagine per la visualizzazione estesa

Figure 1: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Western blot analysis of extracts of C6 cells, using Anti-YAP1 Antibody [ARC53477] (A308258) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Clicca sull'immagine per la visualizzazione estesa

Figure 2: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Western blot analysis of extracts of Mouse heart, using Anti-YAP1 Antibody [ARC53477] (A308258) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 20s.

Clicca sull'immagine per la visualizzazione estesa

Figure 3: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Western blot analysis of extracts from wild type(WT) and YAP1 knockout (KO) HeLa cells, using Anti-YAP1 Antibody [ARC53477] (A308258) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Clicca sull'immagine per la visualizzazione estesa

Figure 4: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunohistochemistry analysis of paraffin-embedded human liver (negative control sample) using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:200(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Clicca sull'immagine per la visualizzazione estesa

Figure 5: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Clicca sull'immagine per la visualizzazione estesa

Figure 6: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Clicca sull'immagine per la visualizzazione estesa

Figure 7: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Clicca sull'immagine per la visualizzazione estesa

Figure 8: Immunofluorescence - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunofluorescence analysis of NIH/3T3 cells using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 9: Immunofluorescence - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunofluorescence analysis of U20S cells using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 10: Immunofluorescence - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunofluorescence analysis of HeLa cells using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Clicca sull'immagine per la visualizzazione estesa

Figure 11: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunoprecipitation analysis of 300µg extracts of A-549 cells using 3µg of Anti-YAP1 Antibody [ARC53477] (A308258). This Western blot was performed on the immunoprecipitate using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:500.

Mostra più immagini

Prodotti alternativi a Anti-YAP1 Anticorpo [ARC53477] (A308258)

(5)

A16747