Anti-NEIL1 Antibody (A9753)

Anti-NEIL1 Antibody

Rabbit polyclonal antibody to NEIL1.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEIL1 (NP_078884.2).

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGP

Rabbit

Polyclonal

IgG

Unconjugated

44 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

DNA (apurinic or apyrimidinic site) lyase Neil1, DNA glycosylase/AP lyase Neil 1, DNA glycosylase/AP lyase Neil1, DNA-(apurinic or apyrimidinic site) lyase Neil1, Endonuclease 8 like 1, Endonuclease 8-like 1, Endonuclease VIII, Endonuclease VIII like 1, Endonuclease VIII-like 1, FLJ22402, FPG1, hFPG1, NEH 1, NEH1, NEI 1, Nei endonuclease VIII like 1, Nei endonuclease VIII like 1 (E. coli), Nei homolog 1, Nei like 1, Nei like protein 1, Nei-like protein 1, NEI1, NEIL 1, NEIL1_HUMAN