Anti-PDZD3 Antibody (A80969)

Anti-PDZD3 Antibody

Rabbit polyclonal antibody to PDZD3.

WB: 1:500-1:2000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PDZD3 (NP_079067.3).

MEKAADLQDTASLTLKFKFNPKLGIDNPVLSLAEDHDPYDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDVVEHEDYAVVVRRIRASSPRVLLTVLARHAHDVARAQLGEDAHLCPTLGPGVRPRLCHIVKDEGGFGFSVTHGNQGPFW

Rabbit

Polyclonal

IgG

Affinity purification.

56kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

IKEPP, Intestinal and kidney-enriched PDZ protein, Na(+)/H(+) exchange regulatory cofactor NHE-RF4, Na/Pi cotransporter C-terminal-associated protein 2, NaPi-Cap2, Natrium-phosphate cotransporter IIa C-terminal-associated protein 2, NHERF-4, NHERF4, PDZ domain-containing protein 2, PDZ domain-containing protein 3, PDZK2, Sodium-hydrogen exchanger regulatory factor 4