Anti-A4GALT Antibody (A12306)

Anti-A4GALT Antibody

Rabbit polyclonal antibody to A4GALT.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1).

WIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL

Rabbit

Polyclonal

IgG

Unconjugated

45 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

4 N acetylglucosaminyltransferase, 4-galactosyltransferase, 4-N-acetylglucosaminyltransferase, A14GALT, A4GALT1, A4GAT_HUMAN, Alpha 1 4 galactosyltransferase, Alpha 1 4 N acetylglucosaminyltransferase, Alpha-1, Alpha4Gal T1, Alpha4Gal-T1, CD77 synthase, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, Lactosylceramide 4 alpha galactosyltransferase, Lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP galactose beta D galactosyl beta1 R 4 alpha D galactosyltransferase, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase