Anti-ABCG1 Antibody [ARC0336] (A306633)

Anti-ABCG1 Antibody [ARC0336]

Rabbit monoclonal [ARC0336] antibody to ABCG1.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (P45844).

LLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEI

Rabbit

Monoclonal

ARC0336

IgG

Affinity purification.

110 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ABC transporter 8, ABC8, ABCG1_HUMAN, ATP-binding cassette sub family G member 1, ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette transporter member 1 of subfamily G, ATP-binding cassette, sub family G WHITE member 1, homolog of Drosophila white, MGC34313, White protein homolog, White protein homolog ATP binding cassette transporter 8, WHITE1, WHT1