Acrp30 Human (A61626)

Acrp30 Human

Adiponectin Human Recombinant

Escherichia Coli.

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.

Acrp30 purity is greater than 90% as determined by SDS-PAGE.

Sterile Filtered clear solution.

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

30 kDa adipocyte complement related protein, 30 kDa adipocyte complement-related protein, ACDC, Adipocyte, Adipocyte C1q and collagen domain containing protein, Adipocyte complement related 30 kDa protein, Adipocyte complement related protein of 30 kDa, Adipocyte complement-related 30 kDa protein, adipocyte-specific secretory protein, Adiponectin, Adiponectin precursor, adiponectin, C1Q and collagen domain containing, Adipoq, Adipose most abundant gene transcript 1, Adipose most abundant gene transcript 1 protein, Adipose specific collagen like factor, ADIPO_HUMAN, ADIPQTL1, ADPN, APM 1, apM-1, APM1, C1q and collagen domain-containing protein, GBP28, Gelatin binding protein , Gelatin binding protein 28, Gelatin-binding protein