Anti-ACSL1 Antibody (A91192)

Anti-ACSL1 Antibody

Rabbit polyclonal antibody to ACSL1.

WB, ICC/IF, IP

WB: 1:500-1:1,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2).

TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA

Rabbit

Polyclonal

IgG

Unconjugated

78 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ACS 1, ACS1, ACSL 1, ACSL1_HUMAN, Acyl CoA synthetase 1, Acyl CoA synthetase long chain family member 1, Acyl-CoA synthetase 1, FACL 1, FACL 2, FACL1, FACL2, Fatty acid Coenzyme A ligase long chain 1, Fatty acid Coenzyme A ligase long chain 2, LACS, LACS 1, LACS 2, LACS1, LACS2, Lignoceroyl CoA synthase, Long chain acyl CoA synthetase 1, Long chain acyl CoA synthetase 2, Long chain fatty acid CoA ligase 1, Long chain fatty acid CoA ligase 2, Long chain fatty acid coenzyme A ligase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Long-chain-fatty-acid--CoA ligase 1, Palmitoyl CoA ligase 1, Palmitoyl CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, Paltimoyl CoA ligase 1