+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-alpha smooth muscle Actin Antibody (A89813)

Western Blot - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com +4
$335
Product Datasheet

Rabbit polyclonal antibody to alpha smooth muscle Actin for WB, IHC and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Highlighted products for Anti-alpha smooth muscle Actin Antibody

Western Blot - Anti-alpha smooth muscle Actin Antibody (A82445)
(7)
A82445
1 Citation
Anti-alpha smooth muscle Actin Antibody
Goat polyclonal antibody to alpha smooth muscle Actin for ELISA and WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody - Antibodies.com (A8234)
A8234
Anti-alpha Smooth Muscle Actin Antibody [M16-L]
Rabbit monoclonal (M16-L) antibody to alpha Smooth Muscle Actin for IHC-P and IHC-Fr.
Western Blot - Anti-alpha smooth muscle Actin Antibody (A82445)
(7)
A82445
1 Citation
Anti-alpha smooth muscle Actin Antibody
Goat polyclonal antibody to alpha smooth muscle Actin for ELISA and WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody - Antibodies.com (A8234)
A8234
Anti-alpha Smooth Muscle Actin Antibody [M16-L]
Rabbit monoclonal (M16-L) antibody to alpha Smooth Muscle Actin for IHC-P and IHC-Fr.
Name
Anti-alpha smooth muscle Actin Antibody
Description
Rabbit polyclonal antibody to alpha smooth muscle Actin.
Applications
WB, IHC, ICC/IF
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human a-Smooth Muscle Actin (ACTA2) (NP_001135417.1).
Sequence
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
42 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
a actin, AAT6, ACTA2, ACTA_HUMAN, Actin alpha 2 smooth muscle aorta, Actin aortic smooth muscle, Actin, aortic smooth muscle, ACTSA, ACTVS, Alpha 2 actin, Alpha actin 2, Alpha cardiac actin, alpha sma, Alpha-actin-2, Cell growth inhibiting gene 46 protein, Cell growth-inhibiting gene 46 protein, GIG46, Growth inhibiting gene 46, MYMY5
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-alpha smooth muscle Actin Antibody (A89813)
Western blot analysis of Mouse heart, using Anti-alpha smooth muscle Actin Antibody (A89813) at 1:800 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813)
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-alpha smooth muscle Actin Antibody (A89813) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813)
Immunohistochemistry analysis of paraffin-embedded human esophagus using Anti-alpha smooth muscle Actin Antibody (A89813) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813)
Immunohistochemistry analysis of paraffin-embedded human tonsil (negative control sample) using Anti-alpha smooth muscle Actin Antibody (A89813) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-alpha smooth muscle Actin Antibody (A89813)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-alpha smooth muscle Actin Antibody (A89813)

Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] (A249894) - Antibodies.com
(4)
A249894
Anti-alpha Smooth Muscle Actin Antibody [1A4]
Mouse monoclonal [1A4] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] - BSA and Azide free (A253074) - Antibodies.com
(4)
A253074
Anti-alpha Smooth Muscle Actin Antibody [1A4] - BSA and Azide free
Mouse monoclonal [1A4] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] (A249895) - Antibodies.com
(3)
A249895
Anti-alpha Smooth Muscle Actin Antibody [SPM332]
Mouse monoclonal [SPM332] antibody to alpha Smooth Muscle Actin for IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] - BSA and Azide free (A253075) - Antibodies.com
(3)
A253075
Anti-alpha Smooth Muscle Actin Antibody [SPM332] - BSA and Azide free
Mouse monoclonal [SPM332] antibody to alpha Smooth Muscle Actin for IF and IHC-P.
Antibodies.com Image Placeholder - Discover more for less
A279072
Anti-alpha Smooth Muscle Actin Antibody [1A4]
Mouse monoclonal [1A4] antibody to alpha Smooth Muscle Actin for WB, IHC-P, IHC-Fr, ELISA and IF.
Antibodies.com Image Placeholder - Discover more for less
A115506
Anti-alpha Smooth Muscle Actin Antibody [1A4]
Mouse monoclonal [1A4] antbody to alpha Smooth Muscle Actin for Electron microscopy, ICC, IHC-Fr, IHC-P and WB.
Antibodies.com Image Placeholder - Discover more for less
A115508
Anti-alpha Smooth Muscle Actin Antibody [HHF35]
Mouse monoclonal [HHF35] antbody to alpha Smooth Muscle Actin for Electron microscopy, ELISA, ICC, IHC-Fr, IHC-P and WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] (A249896) - Antibodies.com
(6)
A249896
Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791]
Mouse monoclonal [ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Western Blot - Anti-alpha smooth muscle Actin Antibody [ARC0298] (A307100) - Antibodies.com
(5)
A307100
Anti-alpha smooth muscle Actin Antibody [ARC0298]
Rabbit monoclonal [ARC0298] antibody to alpha smooth muscle Actin for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] (A249897) - Antibodies.com
(6)
A249897
Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791]
Mouse monoclonal [1A4 + ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] - BSA and Azide free (A253076) - Antibodies.com
(6)
A253076
Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] - BSA and Azide free
Mouse monoclonal [ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] - BSA and Azide free (A253077) - Antibodies.com
(6)
A253077
Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] - BSA and Azide free
Mouse monoclonal [1A4 + ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] (A249894) - Antibodies.com
(4)
A249894
Anti-alpha Smooth Muscle Actin Antibody [1A4]
Mouse monoclonal [1A4] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] - BSA and Azide free (A253074) - Antibodies.com
(4)
A253074
Anti-alpha Smooth Muscle Actin Antibody [1A4] - BSA and Azide free
Mouse monoclonal [1A4] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] (A249895) - Antibodies.com
(3)
A249895
Anti-alpha Smooth Muscle Actin Antibody [SPM332]
Mouse monoclonal [SPM332] antibody to alpha Smooth Muscle Actin for IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] - BSA and Azide free (A253075) - Antibodies.com
(3)
A253075
Anti-alpha Smooth Muscle Actin Antibody [SPM332] - BSA and Azide free
Mouse monoclonal [SPM332] antibody to alpha Smooth Muscle Actin for IF and IHC-P.
Antibodies.com Image Placeholder - Discover more for less
A279072
Anti-alpha Smooth Muscle Actin Antibody [1A4]
Mouse monoclonal [1A4] antibody to alpha Smooth Muscle Actin for WB, IHC-P, IHC-Fr, ELISA and IF.
Antibodies.com Image Placeholder - Discover more for less
A115506
Anti-alpha Smooth Muscle Actin Antibody [1A4]
Mouse monoclonal [1A4] antbody to alpha Smooth Muscle Actin for Electron microscopy, ICC, IHC-Fr, IHC-P and WB.
Antibodies.com Image Placeholder - Discover more for less
A115508
Anti-alpha Smooth Muscle Actin Antibody [HHF35]
Mouse monoclonal [HHF35] antbody to alpha Smooth Muscle Actin for Electron microscopy, ELISA, ICC, IHC-Fr, IHC-P and WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] (A249896) - Antibodies.com
(6)
A249896
Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791]
Mouse monoclonal [ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Western Blot - Anti-alpha smooth muscle Actin Antibody [ARC0298] (A307100) - Antibodies.com
(5)
A307100
Anti-alpha smooth muscle Actin Antibody [ARC0298]
Rabbit monoclonal [ARC0298] antibody to alpha smooth muscle Actin for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] (A249897) - Antibodies.com
(6)
A249897
Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791]
Mouse monoclonal [1A4 + ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] - BSA and Azide free (A253076) - Antibodies.com
(6)
A253076
Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] - BSA and Azide free
Mouse monoclonal [ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] - BSA and Azide free (A253077) - Antibodies.com
(6)
A253077
Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] - BSA and Azide free
Mouse monoclonal [1A4 + ACTA2/791] antibody to alpha Smooth Muscle Actin for Flow Cytometry, IF and IHC-P.
See all Anti-alpha smooth muscle Actin Antibodies
Main Menu Contact Us 0Checkout
Top