Anti-AMPK gamma 1 Antibody (A306476)

Anti-AMPK gamma 1 Antibody

Rabbit polyclonal antibody to AMPK gamma 1.

WB: 1:100-1:500

Human, Rat

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AMPK?1 (NP_002724.1).

KSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGT

Rabbit

Polyclonal

IgG

Unconjugated

37 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

5' AMP activated protein kinase gamma 1 subunit, 5' AMP activated protein kinase subunit gamma 1, 5''-AMP-activated protein kinase subunit gamma-1, AAKG1_HUMAN, AMP activated protein kinase noncatalytic gamma 1 subunit, AMPK gamma 1 chain, AMPK gamma1, AMPK subunit gamma-1, AMPKg, MGC8666, PRKAG 1, PRKAG1, Protein kinase AMP activated gamma 1 non catalytic subunit, protein kinase, AMP-activated, noncatalytic gamma-1