Anti-ANXA4 Antibody (A15145)

Anti-ANXA4 Antibody

Rabbit polyclonal antibody to ANXA4.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human ANXA4 (NP_001144.1).

IEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Rabbit

Polyclonal

IgG

Unconjugated

35kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

35 beta calcimedin, 35-beta calcimedin, AIV, Annexin 4, Annexin A4, Annexin IV, Annexin IV (placental anticoagulant protein II), Annexin IV placental anticoagulant protein II, Annexin-4, AnnexinA4, AnnexinIV, ANX 4, ANX A4, ANX4, ANXA 4, ANXA4 protein, ANXA4_HUMAN, Carbohydrate binding protein P33/P41, Carbohydrate-binding protein p33/p41, Chromobindin 4, Chromobindin-4, Chromobindin4, DKFZp686H02120, Endonexin I, EndonexinI, Lipocortin IV, LipocortinIV, MGC75105, OTTHUMP00000160052, OTTHUMP00000202207, P32.5, P33/41, PAP II, PAP-II, PAPII, PIG 28, PIG28, Placental anticoagulant protein II, PP4 X, PP4-X, PP4X, Proliferation inducing gene 28, Proliferation inducing protein 28, Protein II, Xanx-4, ZAP 36, ZAP36