Anti-AP1M1 Antibody (A12804)

Anti-AP1M1 Antibody

Rabbit polyclonal antibody to AP1M1.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human AP1M1 (NP_115882.1).

MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWR

Rabbit

Polyclonal

IgG

Unconjugated

49 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, AP1M1_HUMAN, AP47, CLAPM2, Clathrin adaptor protein AP47, Clathrin assembly protein complex 1 medium chain, Clathrin assembly protein complex 1 medium chain 1, Clathrin assembly protein complex AP1 mu subunit, Clathrin coat assembly protein AP47, Clathrin coat-associated protein AP47, CLTNM, Golgi adaptor AP 1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, HA1 47 kDa subunit, MU 1A, Mu-adaptin 1, Mu1A-adaptin