Anti-Bcl6 Antibody (A15573)

Anti-Bcl6 Antibody

Rabbit polyclonal antibody to Bcl6.

WB, ICC/IF

WB: 1:500-1:1,000, ICC/IF: 1:50-1:100

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human BCL6 (NP_001124317.1).

SKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIV

Rabbit

Polyclonal

IgG

Unconjugated

86 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

B cell CLL/lymphoma 6, B cell lymphoma 6 protein, B-cell lymphoma 5 protein, B-cell lymphoma 6 protein, BCL 5, Bcl 6, BCL-5, BCL-6, BCL5, BCL6A, BCL6_HUMAN, cys his2 zinc finger transcription factor, LAZ 3, LAZ 3 protein, LAZ3, Lymphoma associated zinc finger gene on chromosome 3, Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3), Protein LAZ-3, ZBTB 27, ZBTB27, Zinc finger and BTB domain containing protein 27, Zinc finger and BTB domain-containing protein 27, Zinc finger and BTB domain-containing protein 27 (ZBTB27), Zinc finger protein 51, Zinc Finger Protein 51 (ZNF51), zinc finger transcription factor BCL6S, ZNF 51, ZNF51