Anti-BMAL1 Antibody [ARC1101] (A305303)

Anti-BMAL1 Antibody [ARC1101]

Rabbit monoclonal [ARC1101] antibody to BMAL1.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 500-600 of human BMAL1 (O00327).

AEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM

Rabbit

Monoclonal

ARC1101

IgG

Unconjugated

78 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ARNT like protein 1 brain and muscle, Arntl, Aryl hydrocarbon receptor nuclear translocator like, Aryl hydrocarbon receptor nuclear translocator like protein 1, Aryl hydrocarbon receptor nuclear translocator-like protein 1, Basic helix loop helix PAS orphan MOP3, Basic helix loop helix PAS protein MOP3, Basic-helix-loop-helix-PAS protein MOP3, bHLH PAS protein JAP3, bHLH-PAS protein JAP3, bHLHe5, BMAL 1, BMAL1c, BMAL1_HUMAN, Brain and muscle ARNT like 1, Brain and muscle ARNT-like 1, CG8727 PA, Class E basic helix-loop-helix protein 5, cycle, JAP 3, JAP3, Member of PAS protein 3, Member of PAS superfamily 3, MGC47515, MOP 3, MOP3, PAS domain-containing protein 3, PASD 3, PASD3, TIC