BMP 7 Human, Plant (A61415)

BMP 7 Human, Plant

Bone Morphogenetic Protein-7 Human Recombinant, Plant

Nicotiana benthamiana.

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.

Greater than 97.0% as determined by SDS-PAGE.

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

BMP-7, BMP7, BMP7_HUMAN, Bone morphogenetic protein 7, Bone morphogenic protein 7, Eptotermin alfa, OP 1, OP-1, OP1, Osteogenic protein 1