Anti-BRG1 Antibody (A92840)

Anti-BRG1 Antibody

Rabbit polyclonal antibody to BRG1.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:20-1:50

Human

A synthetic peptide corresponding to a sequence within amino acids 30-130 of human BRG1/BRG1/SMARCA4 (NP_003063.2).

PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF 190, BAF190, BAF190A, Brahma protein like 1, BRG1 associated factor 190A, BRG1 protein, BRG1-associated factor 190A, BRM/SWI2 related gene 1, Global transcription activator homologous sequence, global transcription activator snf2l4, Homeotic gene regulator, hSNF2b, Mitotic growth and transcription activator, MRD16, Nuclear protein GRB1, Protein brahma homolog 1, Protein BRG-1, Protein BRG1, RTPS2, SMARC A4, SMARCA4, SMCA4_HUMAN, SNF2, SNF2 beta, SNF2 like 4, SNF2-beta, SNF2B, SNF2L4, SNF2LB, Sucrose nonfermenting like 4, SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 4, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4, SWI2, Transcription activator BRG1