Anti-BTNL2 Antibody (A92292)

Anti-BTNL2 Antibody

Rabbit polyclonal antibody to BTNL2.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 246-455 of human BTNL2 (NP_062548.1).

LKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BTL-II, Butyrophilin-like protein 2