Anti-C1 inhibitor Antibody [ARC2427] (A308724)

Anti-C1 inhibitor Antibody [ARC2427]

Rabbit monoclonal [ARC2427] antibody to C1 inhibitor.

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SERPING1 (P05155).

SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV

Rabbit

Monoclonal

ARC2427

IgG

Affinity purification.

100 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C1 esterase inhibitor, C1 Inactivator, C1 Inh, C1 inhibiting factor, C1-inhibiting factor, C1IN, C1Inh, C1NH, complement component 1 inhibitor, esterase inhibitor, HAE1, HAE2, IC1_HUMAN, Plasma protease C1 inhibitor, Serine (or cysteine) proteinase inhibitor clade G member 1, serine/cysteine proteinase inhibitor clade G member 1, Serpin G1, serpin peptidase inhibitor, clade G (C1 inhibitor), member 1, SERPING1