Anti-CARD8 Antibody (A12607)

Anti-CARD8 Antibody

Rabbit polyclonal antibody to CARD8.

WB: 1:500-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CARD8 (NP_003796.1).

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

Rabbit

Polyclonal

IgG

Unconjugated

60 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Apoptotic protein NDPP 1, Apoptotic protein NDPP1, CARD 8, CARD inhibitor of NF kappa B activating ligand, CARD inhibitor of NF kappaB activating ligand, CARD inhibitor of NF kappaB activating ligands, CARD-inhibitor of NF-kappa-B-activating ligand, CARD8_HUMAN, CARDINAL, Caspase recruitment domain containing protein 8, Caspase recruitment domain family member 8, Caspase recruitment domain protein 8, Caspase recruitment domain-containing protein 8, DACAR, Dakar, DKFZp779L0366, FLJ18119, FLJ18121, KIAA0955, MGC57162, NDPP, NDPP 1, NDPP1, TUCAN, Tumor up regulated CARD containing antagonist of CASP9, Tumor up regulated CARD containing antagonist of caspase 9, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine, Tumor upregulated CARD containing antagonist of CASP9