Anti-ACF1 / BAZ1A Antibody (A91842)

Anti-ACF1 / BAZ1A Antibody

Rabbit polyclonal antibody to ACF1 / BAZ1A.

WB: 1:500-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1347-1556 of human BAZ1A (NP_038476.2).

VFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSVNIASKLSLQESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI

Rabbit

Polyclonal

IgG

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Acf1, ACF1, drosophila, homolog of, ATP dependent chromatin remodelling protein, ATP utilizing chromatin assembly and remodeling factor 1, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, B930060C03, Baz1a, BAZ1A_HUMAN, BC065123, Bromodomain adjacent to zinc finger domain 1A, Bromodomain adjacent to zinc finger domain protein 1A, cbp146, CHRAC subunit ACF1, DKFZp586E0518, FLJ14383, Gtl5, hACF1, hWALp1, WALp1, WCRF180, Williams syndrome transcription factor related chromatin remodeling factor 180, Williams syndrome transcription factor-related chromatin-remodeling factor 180