Anti-ACP1 Antibody (A92149)

Anti-ACP1 Antibody

Rabbit polyclonal antibody to ACP1.

WB: 1:500-1:2000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 15-144 of human ACP1 (NP_004291.1).

GNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQ

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Adipocyte acid phosphatase, EC:3.1.3.2, LMW-PTP, LMW-PTPase, Low molecular weight cytosolic acid phosphatase, Low molecular weight phosphotyrosine protein phosphatase, Red cell acid phosphatase 1