Anti-alpha A Crystallin / CRYAA Antibody [c9F2] (A279965)

Anti-alpha A Crystallin / CRYAA Antibody [c9F2]

Mouse monoclonal [c9F2] antibody to alpha A Crystallin / CRYAA.

This antibody recognises alpha A crystallin, a 20 kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB4, which acts as a molecular chaperone and is believed to play a role in the maintenance of ocular lens transparency/refractive index.Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus.

ELISA, WB

WB: 1:1,000 - 1:2,000

Human, Rat

E. coli derived recombinant protein corresponding to full-length (amino acids 1-173) human crystallin alpha A.

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Mouse

Monoclonal

c9F2

Protein G affinity chromatography of ascites.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 10% Glycerol and 0.02% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human Alpha A Crystallin antibody, clone c9F2 recognizes alpha A crystallin, a 20 kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB4, which acts as a molecular chaperone and is believed to play a role in the maintenance of ocular lens transparency/refractive index.Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus.