Anti-AMICA1 Antibody (A92333)

Anti-AMICA1 Antibody

Rabbit polyclonal antibody to AMICA1.

WB: 1:500-1:2000

Human, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 285-384 of human AMICA1 (NP_694938.2).

IVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Adhesion molecule interacting with CXADR antigen 1, Dendritic cell-specific protein CREA7-1, Junctional adhesion molecule-like