Anti-BCRP/ABCG2 Antibody [ARC0383] (A308669)

Anti-BCRP/ABCG2 Antibody [ARC0383]

Rabbit monoclonal [ARC0383] antibody to BCRP/ABCG2.

WB: 1:500-1:2,000

Human

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG2 (Q9UNQ0).

SGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL

Rabbit

Monoclonal

ARC0383

IgG

Lot Specific

72 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

ABC transporter, ABC15, ABCG 2, ABCG2, ABCG2_HUMAN, ABCP, ATP binding cassette sub family G (WHITE) member 2, ATP binding cassette transporter G2, ATP-binding cassette sub-family G member 2, BCRP, BCRP1, BMDP, Breast cancer resistance protein, CD338, CDw338, CDw338 antigen, EST157481, GOUT1, MGC102821, Mitoxantrone resistance associated protein, Mitoxantrone resistance-associated protein, MRX, Multi drug resistance efflux transport ATP binding cassette sub family G (WHITE) member 2, MXR, MXR1, Placenta specific ATP binding cassette transporter, Placenta specific MDR protein, Placenta-specific ATP-binding cassette transporter, UAQTL1