Anti-cAMP Protein Kinase Catalytic Subunit alpha Antibody (A283705)

Anti-cAMP Protein Kinase Catalytic Subunit alpha Antibody

Rabbit polyclonal antibody to cAMP Protein Kinase Catalytic Subunit alpha.

This antibody recognises cAMP-dependent protein kinase catalytic subunit alpha, also known as PRKACA. The function and specificity of PKA C-alpha depend on subcellular localization, expression of isoforms and physio-chemical features (Søberg et al. 2013, Skalhegg and Tasken 2000). It phosphorylates a large number of proteins, for example, p50 at serine 337 , claudin-4 at threonine 192 (D'Souza et al. 2005). Dnajb1–Prkaca gene fusion drives tumorigenesis in mice.

WB: 1:500 - 1:2,000

Human

Synthetic peptide corresponding to amino acids 9-40 of human PKA C-alpha.

KGSEQESVKEFLAKAKEDFLKKWESPAQNTAH

Rabbit

Polyclonal

IgG

Lot Specific

Approximately 41 kDa in HeLa cell lysate under reducing conditions

Liquid

Supplied in Phosphate Buffered Saline with 0.05% ProClin 300 and 50% Glycerol.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti PKA C-alpha antibody recognizes cAMP-dependent protein kinase catalytic subunit alpha, also known as PRKACA. The function and specificity of PKA C-alpha depend on subcellular localization, expression of isoforms and physio-chemical features (Søberg et al. 2013, Skalhegg and Tasken 2000). It phosphorylates a large number of proteins, for example, p50 at serine 337 (Guan et al. 2005), claudin-4 at threonine 192 (D'Souza et al. 2005). Dnajb1–Prkaca gene fusion drives tumorigenesis in mice (Kastenhuber et al. 2017).