Anti-Caveolin-3 Antibody [CD05-4A6] (A320296)

Anti-Caveolin-3 Antibody [CD05-4A6]

Mouse monoclonal [CD05-4A6] antibody to Caveolin-3.

This antibody recognises caveolin 3, also known as M-caveolin.Caveolin 3 is the major structural protein of caveolae in muscle. Mutations in the CAV3 gene have been shown to result in a number of different types of myopathies with altered membrane integrity and repair, protein expression, and cell signaling regulation in the cells of muscle tissue. Up-regulation of caveolin in senescent cells attenuates EGF signaling.

WB: 1:2,000

Human, Mouse

E. coli derived recombinant protein corresponding to amino acids 1-83 of human caveolin 3.

MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP

Mouse

Monoclonal

CD05-4A6

IgG1

1 mg/ml

19 kDa in mouse heart tissue lysate

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti human caveolin 3 antibody, clone CD05-4A6 recognizes caveolin 3, also known as M-caveolin.Caveolin 3 is the major structural protein of caveolae in muscle. Mutations in the CAV3 gene have been shown to result in a number of different types of myopathies with altered membrane integrity and repair, protein expression, and cell signaling regulation in the cells of muscle tissue (Dewulf et al. 2019). Up-regulation of caveolin in senescent cells attenuates EGF signaling (Park et al. 2019).

CAV3, M-caveolin