Anti-CRHBP Antibody (A92308)

Anti-CRHBP Antibody

Rabbit polyclonal antibody to CRHBP.

WB: 1:1000-1:2000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 25-322 of human CRHBP (NP_001873.2).

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Corticotropin-releasing factor-binding protein, Corticotropin-releasing hormone-binding protein, CRF-binding protein, CRF-BP, CRFBP, CRH-BP