Anti-Ctip1 / BCL-11A Antibody [BCL11A/123] (A320282)

Anti-Ctip1 / BCL-11A Antibody [BCL11A/123]

Mouse monoclonal [BCL11A/123] antibody to Ctip1 / BCL-11A.

This antibody recognises b-cell lymphoma/leukemia 11A, also known as B-cell CLL/lymphoma 11A, COUP-TF-interacting protein 1, ecotropic viral integration site 9 protein homolog or zinc finger protein 856.BCL11A is a regulatory C2H2 type zinc-finger protein that can bind to DNA. BCL11A has been shown to interact with the SWI/SNF complex, which regulates gene expression via chromatin remodeling. BCL11A is highly expressed in several types of blood cells as well as the brain, where it is involved in the regulation of axon outgrowth and branching. Mouse anti Human BCL11A antibody, clone BCL11A/123 detects a band of 100 kDa.

WB: 1 µg/ml - 2 µg/ml

Human

A recombinant protein corresponding to amino acids 637-835 of BCL11A-XL (B-cell lymphoma/leukemia 11A extra long form).

KLEKEFDLPPAAMPNTENVYSQWLAGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE

Mouse

Monoclonal

BCL11A/123

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.035% Sodium Azide and 30% Glycerol.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human BCL11A antibody, clone BCL11A/123 recognizes B-cell lymphoma/leukemia 11A, also known as B-cell CLL/lymphoma 11A, COUP-TF-interacting protein 1, ecotropic viral integration site 9 protein homolog or zinc finger protein 856.BCL11A is a regulatory C2H2 type zinc-finger protein that can bind to DNA. BCL11A has been shown to interact with the SWI/SNF complex, which regulates gene expression via chromatin remodeling (Kadoch et al. 2013). BCL11A is highly expressed in several types of blood cells as well as the brain, where it is involved in the regulation of axon outgrowth and branching (Kuo et al. 2010).Mouse anti Human BCL11A antibody, clone BCL11A/123 detects a band of 100 kDa.