Anti-EBF4 Antibody (A91635)

Anti-EBF4 Antibody

Rabbit polyclonal antibody to EBF4.

WB: 1:500-1:2000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBF4 (NP_001103984.1).

HFEKQPPSNLRKSNFFHFVLAMYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQAIIYEGQDKNPEMCRV

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

COE4, Early B-cell factor 4, EBF-4, KIAA1442, O/E-4, OE-4, Olf-1/EBF-like 4, Transcription factor COE4