Anti-EFCAB7 Antibody (A92167)

Anti-EFCAB7 Antibody

Rabbit polyclonal antibody to EFCAB7.

WB: 1:500-1:2000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 170-400 of human EFCAB7 (NP_115813.2).

TNEQCLKTTLEKLEVDSKLMRHQFGNHIEGSPERDPSPVPKPSPKITRKTDPETFLNKGDTRSSLLSATRKFKTSVSFTVTMGANGNRNSKLMEPNLIKDWQHMQSKGCFFLEEDGEIISHQYRMQIAQRSMVYLTIKPLNLSQVEGKPSPWLSVDTALYILKENESQANLQLVCFTELRNREVFGWTGELGPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFL

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

EF-hand calcium-binding domain-containing protein 7, KIAA1799