Anti-EHMT2/G9A Antibody (A11527)

Anti-EHMT2/G9A Antibody

Rabbit polyclonal antibody to EHMT2/G9A.

WB: 1:500-1:1,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 680-813 of human EHMT2 (NP_006700.3).

SDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTL

Rabbit

Polyclonal

IgG

Affinity purification.

130 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Ankyrin repeat containing protein, Bat 8, Bat8, C6orf30, DKFZp686H08213, EHMT 2, Ehmt2, EHMT2_HUMAN, Euchromatic histone lysine methyltransferase 2, Euchromatic histone lysine N methyltransferase 2, Euchromatic histone-lysine N-methyltransferase 2, FLJ35547, G 9a, G9 a, G9A, G9A histone methyltransferase, G9a protein, GAT8, H3 K9 HMTase 3, H3-K9-HMTase 3, Histone H3 K9 methyltransferase 3, Histone H3 K9 methyltransferase3, Histone H3-K9 methyltransferase 3, Histone lysine N methyltransferase, Histone lysine N methyltransferase EHMT2, Histone lysine N methyltransferase, H3 lysine 9 specific 3, Histone lysine N methyltransferase, H3 lysine 9 specific3, Histone-lysine N-methyltransferase EHMT2, HLA B associated transcript 8, HLA-B-associated transcript 8, KMT 1C, KMT1 C, Lysine N methyltransferase 1C, Lysine N-methyltransferase 1C, NG 36, NG36, Protein G9a