Anti-Frizzled 5 Antibody [CD02-3B3] (A320302)

Anti-Frizzled 5 Antibody [CD02-3B3]

Mouse monoclonal [CD02-3B3] antibody to Frizzled 5.

This antibody recognises the Frizzled-5 protein, also known as FZD5 or C2orf31.Frizzled proteins are G-protein coupled receptors which have the ability to bind to WNT ligands. When FZD5 is bound to WNT ligand WNT7A, the resulting signals induce an increase in endometrial and ovarian cell cancer proliferation and growth via the ß-catenin pathway.

WB: 1:2,000

Human, Mouse, Rat

E. coli derived recombinant protein corresponding to amino acids 27-238 of human Frizzled-5.

ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFW

Mouse

Monoclonal

CD02-3B3

IgG1

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

61 kDa in HepG2 cell lysates

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti human Frizzled-5, clone CD02-3B3 recognizes the Frizzled-5 protein, also known as FZD5 or C2orf31.Frizzled proteins are G-protein coupled receptors which have the ability to bind to WNT ligands. When FZD5 is bound to WNT ligand WNT7A, the resulting signals induce an increase in endometrial and ovarian cell cancer proliferation and growth via the ß-catenin pathway. (Dong et al. 2021).

C2orf31, Frizzled-5, Fz-5, FZD5, FzE5, hFz5