Anti-FUCA1 Antibody (A9830)

Anti-FUCA1 Antibody

Rabbit polyclonal antibody to FUCA1.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 20-260 of human FUCA1 (NP_000138.2).

LFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGVFIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWLYNDSPVKDEVV

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, Tissue alpha-L-fucosidase