Anti-GCNT2 Antibody (A9932)

Anti-GCNT2 Antibody

Rabbit polyclonal antibody to GCNT2.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 203-402 of human GCNT2 (NP_663630.2).

IVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

GCNT5, I-branching enzyme, IGNT, II, N-acetylglucosaminyltransferase, N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, NACGT1