Anti-GDI2 Antibody (A283722)

Anti-GDI2 Antibody

Rabbit polyclonal antibody to GDI2.

This antibody recognises Rab GDP dissociation inhibitor beta, also known as Rab GDI beta, GDI-2, guanosine diphosphate dissociation inhibitor 2. GDI-2 is a member of a family of chaperone proteins, which control Rho GTPases. It has been shown to function as a metastasis suppressor in bladder cancer

WB: 1:200 - 1:3,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI-2.

QVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED

Rabbit

Polyclonal

IgG

Lot Specific

Approximately 51 kDa in various cell and tissue lysates under reducing conditions

Liquid

Supplied in Phosphate Buffered Saline with 50% Glycerol and <0.1% Sodium Azide.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti GDI-2 antibody recognizes Rab GDP dissociation inhibitor beta, also known as Rab GDI beta, GDI-2, guanosine diphosphate dissociation inhibitor 2. GDI-2 is a member of a family of chaperone proteins, which control Rho GTPases (DerMardirossian and Bokoch 2005). It has been shown to function as a metastasis suppressor in bladder cancer (Gildea et al. 2002)

GDI-2, Guanosine diphosphate dissociation inhibitor 2, Rab GDI beta, Rab GDP dissociation inhibitor beta, RABGDIB