Anti-Glucose Transporter GLUT1 Antibody (A80666)

Anti-Glucose Transporter GLUT1 Antibody

Rabbit polyclonal antibody to Glucose Transporter GLUT1.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human GLUT1/SLC2A1 (NP_006507.2).

RPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

Rabbit

Polyclonal

IgG

Affinity purification.

50 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

Choreoathetosis/spasticity episodic (paroxysmal choreoathetosis/spasticity), CSE, DYT17, DYT18, DYT9, EIG12, erythrocyte/brain, Erythrocyte/hepatoma glucose transporter, facilitated glucose transporter member 1, Glucose transporter 1, Glucose transporter type 1, Glucose transporter type 1, erythrocyte/brain, GLUT, GLUT-1, GLUT1, GLUT1DS, GLUTB, GT1, GTG1, Gtg3, GTR1_HUMAN, HepG2 glucose transporter, HTLVR, Human T cell leukemia virus (I and II) receptor, MGC141895, MGC141896, PED, RATGTG1, Receptor for HTLV 1 and HTLV 2, SLC2A1, Solute carrier family 2, Solute carrier family 2 (facilitated glucose transporter), member 1, Solute carrier family 2, facilitated glucose transporter member 1