Anti-GPCR GPR37 Antibody (A90885)

Anti-GPCR GPR37 Antibody

Rabbit polyclonal antibody to GPCR GPR37.

WB: 1:500-1:2,000

Human, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 40-180 of human GPR37 (NP_005293.1).

LGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF

Rabbit

Polyclonal

IgG

Affinity purification.

67 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

EDNRBL, Endothelin B receptor like protein 1, Endothelin B receptor-like protein 1, Endothelin receptor type B like, ETBR LP 1, ETBR-LP-1, ETBRLP1, G protein coupled receptor 37, G protein coupled receptor 37 endothelin receptor type B like, Gpr37, GPR37_HUMAN, hET(B)R LP, hET(B)RLP, PAELR, Parkin associated endothelin receptor like receptor, Parkin-associated endothelin receptor-like receptor, Probable G protein coupled receptor 37, Probable G-protein coupled receptor 37