Anti-GPCR GPR81 Antibody (A308591)

Anti-GPCR GPR81 Antibody

Rabbit polyclonal antibody to GPCR GPR81.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 250-346 of human HCAR1 (NP_115943.1).

SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH

Rabbit

Polyclonal

IgG

Lot Specific

39 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

FKSG80, FKSG80 protein, G protein coupled receptor 104, G protein coupled receptor 81, G protein coupled receptor GPR81, G-protein coupled receptor 104, G-protein coupled receptor 81, GPR 104, GPR 81, GPR104, GPR81, GPR81_HUMAN, HCA1, HCAR1, hydroxy-carboxylic acid receptor 1, Hydroxycarboxylic acid receptor 1, LACR1, lactate receptor 1, Putative chemokine receptor, T cell activation G protein coupled receptor, TA GPCR