Anti-GRB10 Antibody [E01/5G4] (A320287)

Anti-GRB10 Antibody [E01/5G4]

Mouse monoclonal [E01/5G4] antibody to GRB10.

This antibody recognises growth-factor receptor bound protein 10, also known as GRB10 adapter protein or Insulin receptor-binding protein Grb-IR.GRB10 is a signal adapter protein involved in a number of cellular processes including growth control, cellular proliferation, and insulin signaling. GRB10 may play a functional role in motor neurons and other neuronal tissues.

WB: 1:10,000

Human, Mouse, Rat

E. coli derived recombinant protein corresponding to amino acids 1-282 of human GRB10.

MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQ

Mouse

Monoclonal

E01/5G4

IgG2b

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

67 kDa in HepG2 cell lysates

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human GRB10 antibody recognizes growth-factor receptor bound protein 10, also known as GRB10 adapter protein or Insulin receptor-binding protein Grb-IR.GRB10 is a signal adapter protein involved in a number of cellular processes including growth control, cellular proliferation, and insulin signaling. GRB10 may play a functional role in motor neurons and other neuronal tissues (Plasschaert and Bartolomei, 2015).

GRB10 adapter protein, GRBIR, Growth factor receptor-bound protein 10, Insulin receptor-binding protein Grb-IR, KIAA0207