Anti-GRB14 Antibody [I01-10B4] (A320298)

Anti-GRB14 Antibody [I01-10B4]

Mouse monoclonal [I01-10B4] antibody to GRB14.

This antibody recognises growth factor receptor-bound protein (GRB) 14, also known as GRB14 adapter protein.GRB14 is an adapter molecule of the GRB7/10/14 family. GRB14 has been shown to inhibit insulin receptor (IR) catalytic activity and mediate peptide substrate binding. Members of this GRB family have also been shown to interact with other kinases through their SH2 domain. GRB14 is thought to play a role in the regulation of receptor signaling and modulation of thyroid cancer progression.

WB: 1:1,000

Human, Mouse, Rat

E. coli derived recombinant protein corresponding to amino acids 75-249 of human GRB14.

MPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKK

Mouse

Monoclonal

I01-10B4

IgG2b

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

60 kDa in K562 cell lysates

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti human GRB14 antibody, clone I01-10B4 recognizes growth factor receptor-bound protein (GRB) 14, also known as GRB14 adapter protein.GRB14 is an adapter molecule of the GRB7/10/14 family. GRB14 has been shown to inhibit insulin receptor (IR) catalytic activity and mediate peptide substrate binding. Members of this GRB family have also been shown to interact with other kinases through their SH2 domain. GRB14 is thought to play a role in the regulation of receptor signaling and modulation of thyroid cancer progression (Balogh et al. 2012).

GRB14 adapter protein, Growth factor receptor-bound protein 14