Anti-IL-21R Antibody (A283235)

Anti-IL-21R Antibody

Goat polyclonal antibody to IL-21R.

This antibody recognises an epitope within the N-terminal region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.Interaction between IL-21R and IL-21 results in the activation of several downstream signaling molecules including JAK1 and STAT1 and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.

IHC-P, ELISA

ELISA: 1:50,000, IHC-P: 1:150

Human

Synthetic peptide sequence CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminus of human IL-21R.

CILEMWNLHPSTLTLTWQDQYEELKDEATS

Goat

Polyclonal

IgG

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide.

Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti Human interleukin-21 receptor antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 receptor (IL-21R), a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.Interaction between IL-21R and IL-21 results in the activation of several downstream signaling molecules including JAK1 and STAT1 and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.

CD360, IL-21 receptor, IL21R, Interleukin-21 receptor, NILR, Novel interleukin receptor