Anti-KCNE1 Antibody (A91905)

Anti-KCNE1 Antibody

Rabbit polyclonal antibody to KCNE1.

IHC: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human KCNE1 (NP_001121142.1).

MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Delayed rectifier potassium channel subunit IsK, IKs producing slow voltage-gated potassium channel subunit beta Mink, Minimal potassium channel, MinK, Potassium voltage-gated channel subfamily E member 1