Anti-KCNJ4 Antibody (A91638)

Anti-KCNJ4 Antibody

Rabbit polyclonal antibody to KCNJ4.

WB: 1:500-1:2000

Human

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1).

CVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAV

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Hippocampal inward rectifier, HIR, HIRK2, HRK1, Inward rectifier K(+) channel Kir2.3, Inward rectifier potassium channel 4, IRK-3, IRK3, Potassium channel, inwardly rectifying subfamily J member 4